PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G107900.2
Common NameB456_001G107900, LOC105791081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 229aa    MW: 26007 Da    PI: 6.0373
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G107900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.8e-174287148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg++T+ E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
  Gorai.001G107900.2 42 RGKMTPHEERLVLELHAKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 87
                        89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.972136IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.5E-92248IPR009057Homeodomain-like
SuperFamilySSF466897.94E-222291IPR009057Homeodomain-like
PROSITE profilePS5129425.7763791IPR017930Myb domain
SMARTSM007171.1E-164189IPR001005SANT/Myb domain
PfamPF002493.6E-154286IPR001005SANT/Myb domain
CDDcd001671.34E-124487No hitNo description
Gene3DG3DSA:1.10.10.602.6E-204988IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MGFYSQSFRF EGVAGDNEIG LNRTGKSCRL RWVNYLHPGL KRGKMTPHEE RLVLELHAKW  60
GNRWSRIARK LPGRTDNEIK NYWRTHMRKT AQEKKRAIPI SPSSSSSNCH SSSSTVTTVD  120
SLPSSGTGNI VSFYDTGGLD MAGKKNSPEF EDGNGYSMDD IWKDIDMPEE DTIIKPLPDN  180
YSQQGCNFSW EYCWDSLWKM DDEEESKMFF PPNQLVSCFD FGTESVTG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-17239137105MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-17239191159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-17239191159MYB PROTO-ONCOGENE PROTEIN
1h8a_C4e-17239160128MYB TRANSFORMING PROTEIN
1mse_C3e-17239137105C-Myb DNA-Binding Domain
1msf_C3e-17239137105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00600PBMTransfer from AT5G59780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591432e-49AJ459143.1 Gossypium hirsutum partial myb115c gene, clone pGhMYB115c.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012474433.11e-172PREDICTED: transcription factor MYB48-like isoform X2
SwissprotQ9LX822e-67MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A0D2N7I91e-172A0A0D2N7I9_G
STRINGVIT_06s0004g04140.t011e-81(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.42e-73myb domain protein 48
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]